125181-APC
COL23A1 (Collagen alpha-1(XXIII) Chain, DKFZp434K0621) (APC)
Size
£927.00
- SKU:
- 125181-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa338-410 from human COL23A1 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E10
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Collagen XXIII a1 (COL23A1) is an epithelial cell type 2 transmembrane glycoprotein with multiple collagen-like domains in its extracellular region. Intracellular furin-mediated cleavage of the molecule generates a 58kD shed fragment that forms disulfide-linked trimers. An alternately spliced isoform consists of nearly 300aa of the membrane proximal extracellular domain (ECD), flanked by substituted sequences. COL23A1 is upregulated in many transformed cell lines and serves as an indicator for tumor aggressiveness in prostate cancer. Within the ECD, human COL23A1 shares 89% aa sequence identity with mouse and rat COL23A1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice