125127-BIOTIN

CNKSR3 (Connector Enhancer Of Kinase Suppressor Of Ras 3, Connector Enhancer Of KSR 3, CNK Homolog Protein 3, CNK3, CNKSR Family Member 3, Maguin-like Protein, MAGI1, FLJ31349) (Biotin)

Size

£927.00

SKU:: 125127-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa366-465 from human CNKSR3 (NP_775786) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4A11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: CNKSR3 belongs to the CNKSR family. It contains 1 CRIC domain, 1 DUF1170 domain, 1 PDZ (DHR) domain and 1 SAM (sterile alpha motif) domain. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.