Clusterin (AAG4, APOJ, Apo-J, Apolipoprotein J, CLI, Clusterin precursor, Complement-associated protein SP-40,40, Complement cytolysis inhibitor, KUB1, MGC24903, NA1/NA2, SGP2, SGP-2, SP-40, Testosterone-repressed prostate message 2, TRPM2, TRPM-2)

Size

£685.00

SKU:: 125104
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa402-501 from human CLU (NP_001822) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Clusterin is an ubiquitously expressed protein of two 40kD chains, alpha and beta, covalently joined by disulfide bonds. It exists in two forms; a pro-apoptotic form localized to the nucleus and a pro-survival secreted form. Both are thought to be involved in DNA repair and cell cycle regulation. The secreted form is thought to inhibit apoptotic signalling by BAX, Clusterin suppression can sensitise cells to chemotherapy. Clusterin is overexpressed in human prostate cancer, breast cancers and squamous cell carcinomas. Part of the SC5b-9 complex, clusterin prevents the binding of a C5b-C7 complex to the membrane of the target cell inhibiting the complement cascade. Clusterin acts as an extracellular chaperone inhibiting the formation of human lysozyme amyloid associated with Alzheimer's disease. Clusterin is also important in spermatogenesis and is secreted by Sertoli cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice