125101-ML650
CLTC (Clathrin Heavy Chain 1, Clathrin Heavy Chain on Chromosome 17, CLH-17, CLH17, CLTCL2, KIAA0034) (MaxLight 650)
Size
£914.00
- SKU:
- 125101-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa232-340 from human CLTC (NP_004850) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Clathrin-coated pits, intracellular transport vesicles involved in endocytosis and other membrane trafficking processes, are multi-component units. Clathrin, the most abundant protein in these vesicles, is formed of a basic assembly unit called a triskelion composed of three clathrin heavy chains and three clathrin light chains. Together with other coat components such as AP2, epsin and EPS15, triskelia are targeted to appropriate membrane fusion sites, where subsequent invagination, cargo protein uptake and vesicle internalization occurs. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice