CLIC5 (Chloride Intracellular Channel Protein 5, CLIC5B, dJ447E21.4, FLJ90663, MST130, MSTP130)

Size

£685.00

SKU:: 125080
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa91-191 from human CLIC5 (NP_058625) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Required for normal formation of stereocilia in the inner ear and normal development of the organ of Corti By similarity. Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: FLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.