CLEC4D (C-type Lectin Domain Family 4, Member D, C-type Lectin Superfamily Member 8, C-type Lectin-like Receptor 6, CLEC-6, CLECSF8, MCL, MGC40078, MPCL)

Size

£685.00

SKU:: 125067
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human CLEC4D, aa1-215 (NP_525126.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CLEC4D (C-type lectin domain family 4 member D), also known as CLCSF8, CLEC-6, and MCL, is a 30kD type II transmembrane (TM) glycoprotein that belongs to the CLR (C-type Lectin Receptor) family of molecules. It is synthesized as a 215aa protein that contains a 17aa N-terminal cytoplasmic domain, a 21aa TM segment, and a 177aa C-terminal extracellular region. The extracellular region shows a short stalk and a 118aa CRD (carbohydrate recognition domain). The nature of its carbohydrate ligand is unknown. CLEC4D is restricted to monocytes/macrophages and serves as an endocytic receptor. Homodimers and homotrimers form on the cell surface. The human CLEC4D extracellular region shares 63% aa sequence identity with the mouse extracellular region. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice