125041-BIOTIN
CLDN14 (Claudin-14, UNQ777/PRO1571) (Biotin)
Size
£927.00
- SKU:
- 125041-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa29-82 from CLDN14 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- These proteins consist of 4 hydrophobic transmembrane domains, 2 extracellular loops and short cytoplasmic tails at N and C-termini containing YV and PDZ-domain binding motifs. Claudin 14, a 25kD glycoprotein, is a novel member of this family. It is a vital component of inner ear tight junction strands. Its expression has been observed in sensory epithelium of inner organ of Corti, vestibular system, kidney and Liver. Mutations in Claudin 14 cause a congenital autosomal recessive form of nonsyndromic sensorineural deafness in humans. Applications: Suitable for use in ELISA and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice