125026-PE

CLASP1 (CLIP-associating Protein 1, Cytoplasmic Linker-associated Protein 1, Multiple Asters Homolog 1, Protein Orbit Homolog 1, hOrbit1, KIAA0622, MAST1) (PE)

Size

£914.00

SKU:: 125026-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1133-1227 from CLASP1 (NP_056097) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6A11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: CLASP1 is a nonmotor microtubule-associated protein that interacts with CLIPs (cytoplasmic linker proteins). It belongs to a conserved microtubule-binding protein family that mediates the stabilization of overlapping microtubules of the central spindle. CLASP1 promotes the stabilization of dynamic microtubules, and it is required for the polarization of the cytoplasmic microtubule arrays in migrating cells towards the leading edge of the cell. It may act at the cell cortex to enhance the frequency of rescue of depolymerizing microtubules by attaching their plus-ends to cortical platforms, which are composed of ERC1 and PHLDB2. This cortical microtubule stabilizing activity is regulated at least in part by phosphatidylinositol 3-kinase signaling. Moreover, CLASP1 performs a similar stabilizing function at the kinetochore, which is essential for the bipolar alignment of chromosomes on the mitotic spindle. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DGLAKHPPPFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDLNEPIKRDGKKECDIVSRDGGAASPAT* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice