125015-BIOTIN
CK-BB (CKBB, Creatine Kinase B-type, B-CK, Creatine Kinase B Chain, CKB) (Biotin)
Size
£927.00
- SKU:
- 125015-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-381 from human CKB (AAH01190) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D5-3D11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Creatine Kinase (CK) is a dimeric enzyme composed of either M- or B-type subunits. The resulting isoenzymes are expressed at varying levels in different tissues. CK-BB, a cytoplasmic predominantly found in brain tissues, participates in energy homeostasis, reversibly catalyzing the transfer of a phosphate group between ATP and target proteins such as a creatine phosphate. CK-BB exists in normally neglible amounts in the serum of adults, overexpression of CK-BB is associated with cancers of the breast, ovary, prostate, colon, and in small-cell lung cancer. Global assessment of changes in serum levels of CK-BB, CK-MB and CK-MM, are used as a marker for myocardial infarction. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice