CILP (Cartilage Intermediate Layer Protein 1, CILP-1, Cartilage Intermediate-layer Protein, UNQ602/PRO1188)

Size

£685.00

SKU:: 125007
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa129-227 from CILP (NP_003604) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2C5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The CILP-1 (cartilage intermediate-layer protein 1) gene product is a 138kD monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90kD N-terminal CILP-1, and a 62kD C-terminal NTPPHase-homolog. The N-terminus is suggested to serve as both a matrix structural protein, and an IGF-I/TGF-beta1 suppressor sequestration molecule. Human CILP-1 spans aa22-720 of the CILP-1 precursor. It contains one TSP-1 domain (aa149-201) and a C2-type Ig-like region (aa309-395). Over aa1-720 of the CILP-1 precursor, human CILP-1 shares 89% aa identity with mouse CILP-1, and 42% aa identity with human CILP-2. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice