CHRNA5 (Neuronal Acetylcholine Receptor Subunit alpha-5, NACHRA5)

Size

£685.00

SKU:: 124976
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa38-131 from human CHRNA5 (NP_000736) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Nicotinic acetylcholine receptors, also known as nAChRs, belong to a family of proteins called ligand gated ion channels and are widely expressed throughout the nervous system. nAChRs are made up of 5 subunits (two alpha and three beta). Nicotinic Acetylcholine Receptor a5 has an ax ay beta combination. In the CNS, the a5 subunit is widely expressed in the CA1 area of the hippocampus which affects learning, memory, attention, anxiety, and potentially drug seeking behaviors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.