CHRNA1 (Acetylcholine Receptor Subunit alpha, ACHRA, CHNRA)

Size

£685.00

SKU:: 124973
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa146-231 from human CHRNA1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Applications: Suitable for use in ELISA. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.