CHRAC1 (Chromatin Accessibility Complex Protein 1, CHRAC-1, Chromatin Accessibility Complex 15kD Protein, CHRAC-15, HuCHRAC15, DNA Polymerase Epsilon Subunit p15, CHRAC15)

Size

£685.00

SKU:: 124968
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-132 from human CHRAC1 (AAH15891) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sqeuence: MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.