124958
CHMP2B (Charged Multivesicular Body Protein 2b, CHMP2.5, Chromatin-modifying Protein 2b, CHMP2b, Vacuolar Protein Sorting-associated Protein 2-2, Vps2-2, hVps2-2, CGI-84)
Size
£685.00
- SKU:
- 124958
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-213 from human CHMP2B (AAH01553) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2H6-1E6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- CHMP2B (CHarged Multivescular body Protein 2B; also Chromatin Modifying Protein 2B and Vps22) is a 35kD member of the SNF family of proteins. It is a cytosolic molecule that interacts with VPS4 and undergoes polymerization to form tubules that project plasma membrane outward, generating an environment conducive to membrane fission and budding. It also appears to participate in the formation of intraluminal vesicles associated with the lysosomal system. CHMP2B is found in striated muscle (heart and skeletal), and particularly in neurons of the CNS. Human CHMP2B is 213aa in length. It contains one coiled-coil region (aa25-55), an MIT (microtubule-interacting and trafficking) domain (aa201-211) and a utilized phosphorylation site at Ser199. There is one alternative splice form that shows a deletion of aa2-42. Full length human CHMP2B shares 99% aa identity with mouse CHMP2B, but only 33% aa identity with human CHMP2A. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice