124958-PE
CHMP2B (Charged Multivesicular Body Protein 2b, CHMP2.5, Chromatin-modifying Protein 2b, CHMP2b, Vacuolar Protein Sorting-associated Protein 2-2, Vps2-2, hVps2-2, CGI-84) (PE)
Size
£914.00
- SKU:
- 124958-PE
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-213 from human CHMP2B (AAH01553) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2H6-1E6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- CHMP2B (CHarged Multivescular body Protein 2B; also Chromatin Modifying Protein 2B and Vps22) is a 35kD member of the SNF family of proteins. It is a cytosolic molecule that interacts with VPS4 and undergoes polymerization to form tubules that project plasma membrane outward, generating an environment conducive to membrane fission and budding. It also appears to participate in the formation of intraluminal vesicles associated with the lysosomal system. CHMP2B is found in striated muscle (heart and skeletal), and particularly in neurons of the CNS. Human CHMP2B is 213aa in length. It contains one coiled-coil region (aa25-55), an MIT (microtubule-interacting and trafficking) domain (aa201-211) and a utilized phosphorylation site at Ser199. There is one alternative splice form that shows a deletion of aa2-42. Full length human CHMP2B shares 99% aa identity with mouse CHMP2B, but only 33% aa identity with human CHMP2A. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice