CHIA (Acidic Mammalian Chitinase, AMCase, Lung-specific Protein TSA1902)

Size

£685.00

SKU:: 124943
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human CHIA, aa1-368 (NP_068569.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CHIA degrades chitin and chitotriose. May participate in the defense against nematodes and other pathogens. There are 3 named isoforms produced by alternative splicing. CHIA is induced via a T helper-2 (Th2)-specific, interleukin-13-mediated pathway in epithelial cells and macrophages. CHIA may be an important mediator of IL13-induced responses in Th2-dominated disorders such as asthma. CHIA hydrolysis N-acetyl-beta-D-glucosaminide 1,4-beta-linkages in chitin and chitodextrins. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice