CHAF1B (CAF1A, CAF1P60, MPHOSPH7, MPP7, Chromatin Assembly Factor 1 Subunit B, Chromatin Assembly Factor I p60 Subunit, M-phase Phosphoprotein 7)

Size

£685.00

SKU:: 124922
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa201-300 from CHAF1B (AAH21218) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CHAF1B is required for the assembly of histone octamers onto newly-replicated DNA. CHAF1B is composed of three protein subunits, p50, p60, and p150. The protein corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.