124906-BIOTIN

CFLAR (CASP8 and FADD-like Apoptosis Regulator, Caspase Homolog, CASH, Caspase-eight-related Protein, Casper, Caspase-like Apoptosis Regulatory Protein, CLARP, Cellular FLICE-like Inhibitory Protein, c-FLIP, FADD-like Antiapoptotic Molecule 1, FLAME-1, Inhibitor of FLICE, I-FLICE, MACH-related Inducer of Toxicity, MRIT, Usurpin, CASH, CASP8AP1, CLARP, MRIT) (Biotin)

Size

£927.00

SKU:: 124906-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa178-277 from CFLAR (AAH01602) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity. Applications: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice