CETN3 (Centrin-3, CEN3)

Size

£685.00

SKU:: 124890
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-100 from human CETN3 (AAH05383) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CETN3 contains four EF-hand calcium binding domains, and is a member of the centrin protein family. This protein is ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. It plays a role in centrosome reproduction. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.