CETN3 (Centrin-3, CEN3)

Size

£685.00

SKU:: 124889
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human CETN3, aa1-167 (NP_004356.2).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CETN3 contains four EF-hand calcium binding domains, and is a member of the centrin protein family. This protein is ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. It plays a role in centrosome reproduction. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.