CENPA (Histone H3-like Centromeric Protein A, Centromere Autoantigen A, Centromere Protein A, CENP-A)

Size

£685.00

SKU:: 124842
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-114 from human CENPA (AAH00881) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1D4-1A3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Centromere protein A (CENP-A) is a centromere-specific histone variant which forms an octameric complex with Histones H4, H2A, and H2B, in the presence of DNA. CENP-A defines active centromere regions by forming centromere-specific nucleosomes on which kinetochores are assembled. CENP-A is specifically located to the inner plate of the kinetochore and it is essential for kinetochore targeting of CENP-C and other kinetochore components. CENP-A is required for nucleosomal packaging of centromeric DNA at interphase. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.