CEL (Bile Salt-activated Lipase, BAL, Bile Salt-stimulated Lipase, BSSL, Bucelipase, Carboxyl Ester Lipase, Cholesterol Esterase, Pancreatic Lysophospholipase, Sterol Esterase, BAL)

Size

£685.00

SKU:: 124836
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa378-477 from human CEL (AAH42510) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3C8
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Catalyzes fat and vitamin absorption. Acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.