CEBPG (CCAAT/Enhancer-binding Protein gamma, C/EBP gamma)

Size

£685.00

SKU:: 124832
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-150 from human CEBPG (AAH13128) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A3-1A6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcription factor that binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene. Might change the DNA-binding specificity of other transcription factors and recruit them to unusual DNA sites. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.