CEBPE (CCAAT/Enhancer-binding Protein epsilon, C/EBP epsilon)

Size

£685.00

SKU:: 124829
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-281 from human CEBPE (AAH35797.2) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7A4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CCAAT-enhancer binding protein epsilon (CEBP e) is a 32kD basic-leucine zipper transcription factor that is expressed in myeloblasts, granulocytes, and eosinophils. Multiple isoforms of human CEBP e are generated by alternate splicing and alternative translation initiation sites. All four isoforms contain the bZIP domain (aa208-267) but exert different effects on myeloid differentiation. Full length CEBP e and the 30kD isoform (aa33-281) cooperate with c-Myb to activate the transcription of genes involved in myeloid differentiation. The 27kD isoform (which lacks aa69-97) and the 14kD isoform (which begins at aa153) function as transcriptional repressors in eosinophils. Within aa151-210, human CEBP e shares 93aa sequence identity with mouse and rat CEBP e, respectively. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSP AGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice