CEACAM1 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 1, Biliary Glycoprotein 1, BGP1, BGP-1, BGP, BGPI, CD66a)

Size

£685.00

SKU:: 124824
Purity:: Purified
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa305-414 from human CEACAM1 (BC014473; AAH14473) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2F10
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CD66a is a member of the carcinoembryonic antigen (CEA) family and is expressed by hematopoietic cells. It is also expressed on apical membranes of some epithelia, on endothelium of certain organs and on cells of myeloid lineage, granulocytes and myelocytes. Interestingly, it has been reported to be downregulated in some cancers. This antibody will help detect CD66a expression in a variety of tissues. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: VTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.