CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4)

Size

£685.00

SKU:: 124819
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa71-170 from human CDX4 (NP_005184.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Caudal type homeo box transcription factor 4 (CDX4) is a member of the caudal-type homeobox genes which are candidates for directing tissue and organ development and differentiation. CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. CDX4 is located within the minimal region assigned to XIC in humans and furthermore, CDX4 is the closest known gene to XIST in both mouse and human. Unlike Xist, CDX4 appears to be normally X-inactivated in mice and it is not clear yet whether the location of this gene within the XIC region is of any significance in X-inactivation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice