124819-BIOTIN

CDX4 (Homeobox Protein CDX-4, Caudal-type Homeobox Protein 4) (Biotin)

Size

£927.00

SKU:: 124819-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa71-170 from human CDX4 (NP_005184.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Caudal type homeo box transcription factor 4 (CDX4) is a member of the caudal-type homeobox genes which are candidates for directing tissue and organ development and differentiation. CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. CDX4 is located within the minimal region assigned to XIC in humans and furthermore, CDX4 is the closest known gene to XIST in both mouse and human. Unlike Xist, CDX4 appears to be normally X-inactivated in mice and it is not clear yet whether the location of this gene within the XIC region is of any significance in X-inactivation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice