CDX1 (Homeobox Protein CDX-1, Caudal-type Homeobox Protein 1)

Size

£685.00

SKU:: 124817
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa126-215 from human CDX1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The caudal type homeo box transcription factor 1 (CDX1) and CDX2 are candidates for directing intestinal development, differentiation, and maintenance of the intestinal phenotype. CDX1 is a 265aa protein with 85% identity to mouse Cdx1 (98% identity, including conservative aa changes). CDX1 and CDX2 expression is widely present in the human intestinal and colonic mucosae, but not in the gastric mucosa, suggesting a possible role in the terminal differentiation of the intestine. Decrease in human CDX1 and/or CDX2 expression is associated with colorectal tumorigenesis. On the other hand, increased CDX1 expression is associated with chronic atrophic gastritis. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice