124800-HRP
CDKL2 (Cyclin-dependent Kinase-like 2, Protein Kinase p56 KKIAMRE, Serine/Threonine-protein Kinase KKIAMRE) (HRP)
Size
£914.00
- SKU:
- 124800-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa394-493 from CDKL2 (NP_003939) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- CDKL2 is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the cytoplasm, with a lower level in the nucleus. Applications: Suitable for use in ELISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.7ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: LKDCSNVSVDHTRNPSVAIPPLTHNLSAVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQMEHQH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice