CDC42 (Cell Division Control Protein 42 Homolog, G25K GTP-binding Protein)

Size

£760.00

SKU:: 124747
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CDC42, aa1-191 (NP_001782.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: cdc42/Rac belongs to the superfamily of small GTPases that are structurally linked to the proto-oncogene product p21ras and are important for the control of cell growth and differentiation as well as for intracellular organization. Cdc42/Rac is an important upstream regulator of the protein kinase cascade that controls the SAPK/JNK and p38 activity. Recent data also suggest that constitutive active forms of cdc42 can induce apoptosis through a mechanism requiring signaling through SAPK/JNK. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.