CDC2L6 (CDK19, CDK11, KIAA1028, Cyclin-dependent Kinase 19, CDC2-related Protein Kinase 6, Cell Division Cycle 2-like Protein Kinase 6, Cell Division Protein Kinase 19, Cyclin-dependent Kinase 11, Death-preventing Kinase, bA346C16.3)

Size

£685.00

SKU:: 124742
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-114 from CDC2L6 (NP_055891) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CDC2L6 is one of the components of the mediator coactivator complex. The mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the mediator complex. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRAS* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.