CDK11A (Cyclin-dependent Kinase 11A, Cell Division Cycle 2-like Protein Kinase 2, Cell Division Protein Kinase 11A, Galactosyltransferase-associated Protein Kinase p58/GTA, PITSLRE Serine/Threonine-protein Kinase CDC2L2, CDC2L2, CDC2L3, PITSLREB)

Size

£685.00

SKU:: 124740
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa681-780 from human CDC2L2 (NP_277073) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Three major isoforms of Cdk11 identified are the full length gene product Cdk11p110 and the shorter polypeptides Cdk11p58 and Cdk11p46. Cdk11p110 is a component of RNA polymerase II containing complexes involved in transcriptional regulation, and is implicated in pre-mRNA splicing through interaction with the splicing factor RNPS1 (RNA-binding protein with serine-rich domain 1). Cdk11p58 has been linked with mitosis, cell cycle arrest and apoptosis, and recently implicated as a negative regulator of the androgen receptor (AR) as part of a cyclin D3/ Cdk11p58 complex. Cdk11p46 arises from the cleavage of Cdk11p110 and Cdk11p58 by caspases following the induction of apoptosis, and is linked with apoptotic progression. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Sandwich ELISA: The detection limit is ~0.03ng/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice