124740-ML650
CDK11A (Cyclin-dependent Kinase 11A, Cell Division Cycle 2-like Protein Kinase 2, Cell Division Protein Kinase 11A, Galactosyltransferase-associated Protein Kinase p58/GTA, PITSLRE Serine/Threonine-protein Kinase CDC2L2, CDC2L2, CDC2L3, PITSLREB) (MaxLight 650)
Size
£914.00
- SKU:
- 124740-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa681-780 from human CDC2L2 (NP_277073) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1A9
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Three major isoforms of Cdk11 identified are the full length gene product Cdk11p110 and the shorter polypeptides Cdk11p58 and Cdk11p46. Cdk11p110 is a component of RNA polymerase II containing complexes involved in transcriptional regulation, and is implicated in pre-mRNA splicing through interaction with the splicing factor RNPS1 (RNA-binding protein with serine-rich domain 1). Cdk11p58 has been linked with mitosis, cell cycle arrest and apoptosis, and recently implicated as a negative regulator of the androgen receptor (AR) as part of a cyclin D3/ Cdk11p58 complex. Cdk11p46 arises from the cleavage of Cdk11p110 and Cdk11p58 by caspases following the induction of apoptosis, and is linked with apoptotic progression. Applications: Suitable for use in Immunofluorescence and FLISA. Other applications not tested. Recommended Dilution: Sandwich FLISA: The detection limit is ~0.03ng/ml Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice