CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60)

Size

£685.00

SKU:: 124739
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa21-130 from human CDC25C (AAH19089) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Cdc25C is a tyrosine protein phosphatase required for progression of the cell cycle. Cdc25C activates cell cycle-specific cyclin-dependent kinases (CDKs), including cdc2, via dephosphorylation events. Cdc25C is activated via phosphorylation at Ser216. In response to DNA damage and DNA replicational stress, Chk1 and Chk2 phosphorylate Cdc25C to prevent entry into mitosis. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.