CDC25A (M-phase Inducer Phosphatase 1, Dual Specificity Phosphatase Cdc25A)

Size

£685.00

SKU:: 124734
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa151-250 from human CDC25A with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D5
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: CDC25A, a CDC25 dual specificity protein phosphatase, has been shown to activate the cyclin-dependent kinases at different points of the cell cycle. CDC25A has been shown to affect S phase entry and possibly the initiation of mitosis. CDC25A dephosphorylates cyclin dependent kinases, including Cdk2, Cdk4, as well as non cyclin proteins such as the homeodomain transcription factor cut, the proto-oncogene Raf-1. CDC25A has been implicated in many carcinomas, including those of the colon, lymph node, stomach, ovary, breast. CDC25A is located on chromosome 3p21 in an area frequently involved in karyotypic abnormalities in renal carcinomas, small cell carcinomas of the lung, and benign tumors of the salivary gland. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice