124707-ML490
CD93 (C1QR1, C1qRP, CDw93, ECSM3, MXRA4, C1qR(P), dJ737E23.1, Complement Component C1Q Receptor, C1q/MBL/SPA Receptor, Complement Component 1 q Subcomponent Receptor 1, Matrix-remodeling-associated Protein 4) (MaxLight 490)
Size
£914.00
- SKU:
- 124707-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa33-141 from C1QR1 (NP_036204) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3D12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CD93 is a 110kD O-sialoglycoprotein, known as complement C1q receptor, C1qR1, C1qRp (C1q receptor precursor), or GR11. It is expression on monocytes, granulocytes, platelets, and endothelial cells. CD93 regulates phagocytosis of apoptosis cells, and leukocyte-endothelial cell adhesion. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice