CD84 (SLAM Family Member 5, Cell Surface Antigen MAX.3, Hly9-beta, Leukocyte Differentiation Antigen CD84, Signaling Lymphocytic Activation Molecule 5, SLAMF5, DKFZp781E2378)

Size

£685.00

SKU:: 124694
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-122 from CD84 (NP_003865) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CD84 is a 64-82kD glycoprotein. It is a member of the SLAM (CD150) family, a CD2 subset of the Ig superfamily, also known as SLAMF5 or Ly9b. CD84 is expressed on B cells, monocytes, thymocytes, subset of (preferentially on CD45RO+) T cells, and platelets. CD84 functions as a homophilic adhesion molecule and enhances T cell activation and cytokine production. The antibody CD84.1.21 is able to enhance CD3 induced IFN-g production and partially block CD84-Ig binding to lymphocytes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.