CD79a (B Cell Antigen Receptor Complex-associated Protein alpha Chain, Ig-alpha, MB-1 Membrane Glycoprotein, Membrane-bound Immunoglobulin-associated Protein, Surface IgM-associated Protein, IGA, MB1) (Biotin)

Size

£934.00

SKU:: 124680-BIOTIN
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human CD79A, aa1-226 (NP_001774.1).
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: CD79a, a 32-33KD membrane glycoprotein, is a member of Ig superfamily. It heterodimerizes with CD79b and is non-covalently cross-linked with surface Ig thus forming the BCR complex. It is expressed all stages of differentiation in mature B-cells and is required for cell surface expression and signal transduction by the BCR complex. Upon antigen binding, CD79a/b heterodimer interacts with Tyrosine kinase (Lyn) and gets phosphorylated, resulting in the inititation of intracellular signaling cascade. Pathological role of CD79a has been suggested in B-cell lymphomas and acute lymphoblastic leukemia. CD79a is often used along with CD20 in the detection of normal and neoplastic B-cells in tissue sections. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice