CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41)

Size

£685.00

SKU:: 124675
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa21-240 from human CD7 (AAH09293) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CD7, a 40kD transmembrane glycoprotein, is a novel member of Ig superfamily expressed primarily on thymocytes and mature T-cells. It consists of a extracellullar region with Ig-like domains, a transmembrane region and cytoplasmic tail. It functions as a co-stimulatory molecule regulating the function and development of T-cells and NK cells. It plays a significant role in T-cell interactions and also in T-cell/B-cell interactions during early lymphoid development. Reports suggest CD7 has a key role in regulating integrin-mediated adhesion of T-cells. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice