124675-ML490
CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (MaxLight 490)
Size
£914.00
- SKU:
- 124675-ML490
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa21-240 from human CD7 (AAH09293) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CD7, a 40kD transmembrane glycoprotein, is a novel member of Ig superfamily expressed primarily on thymocytes and mature T-cells. It consists of a extracellullar region with Ig-like domains, a transmembrane region and cytoplasmic tail. It functions as a co-stimulatory molecule regulating the function and development of T-cells and NK cells. It plays a significant role in T-cell interactions and also in T-cell/B-cell interactions during early lymphoid development. Reports suggest CD7 has a key role in regulating integrin-mediated adhesion of T-cells. Applications: Suitable for use in FLISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice