124674-BIOTIN
CD7 (T-cell Antigen CD7, GP40, T-cell Leukemia Antigen, T-cell Surface Antigen Leu-9, TP41) (Biotin)
Size
£934.00
- SKU:
- 124674-BIOTIN
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CD7, aa1-240 (NP_006128.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- CD7, a 40kD transmembrane glycoprotein, is a novel member of Ig superfamily expressed primarily on thymocytes and mature T-cells. It consists of a extracellullar region with Ig-like domains, a transmembrane region and cytoplasmic tail. It functions as a co-stimulatory molecule regulating the function and development of T-cells and NK cells. It plays a significant role in T-cell interactions and also in T-cell/B-cell interactions during early lymphoid development. Reports suggest CD7 has a key role in regulating integrin-mediated adhesion of T-cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice