124672-PE

CD69 (Activation Inducer Molecule, AIM, BLAC/P26, CLEC2C, EA1, Early Activation Antigen CD69, Early T cell Activation Antigen p60, GP32/28, Leu23, MLR-3) (PE)

Size

£914.00

SKU:: 124672-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa90-199 from human CD69 (AAH07037) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: The CD69 cell surface antigen, also known as activation inducer molecule (AIM), is expressed as an early activation marker on T and B lymphocytes. Applications: Suitable for use in FLISA and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.