124654-ML490
CD58 (Lymphocyte Function-associated Antigen 3, Ag3, Surface Glycoprotein LFA-3, LFA3) (MaxLight 490)
Size
£934.00
- SKU:
- 124654-ML490
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human CD58, aa1-250 (NP_001770.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Extra Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. CD58, or LFA-3, is a membrane glycoprotein of 55-70kD. It occurs in two forms, one transmembrane with a cytoplasmic domain, the other form anchored in the membrane via a glycosylphosphatidylinositol tail. The complete amino acid sequence of both forms has been deduced from cDNA. It is heavily N-glycosylated. CD58 is a cell adhesion molecule which plays a critical role in facilitation of antigen specific recognition through interaction with CD2 on T lymphocytes. It is a member of the immunoglobulin superfamily of molecules.CD58 has a wide tissue distribution, being present on erythrocytes, platelets, monocytes, a subset of lymphocytes, bone marrow cells, epithelium and endothelial cells[2]. There are approximately 5,000 CD58 molecules on each erythrocyte. There is reduced expression of CD58 on haemopoietic cells in individuals with paroxysmal nocturnal haemoglobinuria. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice