CD48 (CD48 Antigen, B-lymphocyte Activation Marker BLAST-1, BCM1 Surface Antigen, Leukocyte Antigen MEM-102, TCT.1, BCM1, BLAST1)

Size

£685.00

SKU:: 124641
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-169 from human CD48 (AAH30224) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B8-2C2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 2ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MCSRGWDSCLALELLLLPLSLLVTSIQGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLGESGEPKSKSPLQWPQMDHCRASWEAWGTLGEEERKTSGQV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.