124631
CD42b (Platelet Glycoprotein Ib alpha Chain, GP-Ib alpha, GPIb-alpha, GPIbA, Glycoprotein Ibalpha, Antigen CD42b-alpha, GP1BA, MGC34595)
Size
£685.00
- SKU:
- 124631
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa19-128 from human GP1BA (AAH27955) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1C6
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- CD42b is expressed on platelets and megakaryocytes. CD42b/c heterodimer forms a complex with CD42a and d and acts as the receptor for Von Willibrand factor and thrombin. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice