124617-PE
CD34 (Hematopoietic Progenitor Cell Antigen CD34, CD34 Molecule) (PE)
Size
£914.00
- SKU:
- 124617-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa32-141 from human CD34 (NP_001764) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5F3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- CD34 is thought to function as an adhesion molecule for early hematopoietic progenitors mediating the attachment of stem cells to extracellular matrix or stromal mucosialin. It is selectively expressed on majority of hematopoietic stem/progenitor cells, bone marrow stromal cells, capillary endothelial cells, and embryonic fibroblasts. CD34+ hematopoietic progenitors may be mobilized to the peripheral blood by treatment with recombinant canine granulocyte colony-stimulating factor and stem-cell factor. Furthermore, CD34 is expressed on some canine leukemias. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice