124613-ML650
CD32 (Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, FCGR2B, FCG2, IGFR2) (MaxLight 650)
Size
£914.00
- SKU:
- 124613-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa45-154 from human FCGR2B (AAH31992) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Fcg RII, also known as CD32, is a group of three closely related proteins (Fcg RIIA, Fcg RIIB, Fcg RIIC) that share greater than 94% aa identity in their extracellular domains. They function as transmembrane receptors for the Fc portion of IgG molecules. These proteins are expressed by various hematopoietic cells including monocytes, macrophages, neutrophils, NK cells, T cells, and B cells. The Fcg RII proteins are involved in phagocytosis of immune complexes and modulation of antibody production by B cells. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVVRCHS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice