CD30 (Tumor Necrosis Factor Receptor Superfamily Member 8, CD30L Receptor, Ki-1 Antigen, Lymphocyte Activation Antigen CD30, D1S166E, TNFRSF8)

Size

£685.00

SKU:: 124597
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa21-133 from human TNFRSF8 (NP_001234) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: CD30 is a 105kD type I transmembrane glycoprotein, also known as Ber-H2 or Ki-1. It is a member of the tumor necrosis factor receptor (TNFR) superfamily, expressed on activated T, B, and NK cells, and monocytes. CD28, in conjunction with several cytokines, regulates the expression of CD30 on activated T cells. It has been reported that cytokine production and Th1 versus Th2 development is heavily influenced by CD30-CD30 ligand (CD153) interactions. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.