124567-BIOTIN
CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (Biotin)
Size
£927.00
- SKU:
- 124567-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa210-297 from human MS4A1 (AAH02807) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5C11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Members of MS4A protein family are characterized by the presence of 4 highly conserved transmembrane domains. CD20, a 35-37kD Human B-cell specific tetraspan membrane protein, is a unique member of this family. CD20 plays a major role in the initiation of intracellular signaling and regulating B-cell growth and differentiation. It complexes with BCR and regulates Calcium ion entry, thereby regulating B-cell signaling and activation. Antibodies such as Rituximab directed against CD20 are being extensively used for the treatment of B-cell lymphomas. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice