124567-APC
CD20 (B1, B-lymphocyte Antigen CD20, B-lymphocyte Surface Antigen B1, Bp35, CVID5, Leukocyte Surface Antigen Leu-16, LEU-16, Membrane-spanning 4-domains Subfamily A Member 1, MS4A1, MS4A2, MGC3969, S7) (APC)
Size
£927.00
- SKU:
- 124567-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa210-297 from human MS4A1 (AAH02807) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5C11
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Members of MS4A protein family are characterized by the presence of 4 highly conserved transmembrane domains. CD20, a 35-37kD Human B-cell specific tetraspan membrane protein, is a unique member of this family. CD20 plays a major role in the initiation of intracellular signaling and regulating B-cell growth and differentiation. It complexes with BCR and regulates Calcium ion entry, thereby regulating B-cell signaling and activation. Antibodies such as Rituximab directed against CD20 are being extensively used for the treatment of B-cell lymphomas. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice